PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr1P06400_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 516aa    MW: 57639.4 Da    PI: 7.1299
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr1P06400_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.21.4e-083143511954
                            HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            Fe   ++yp+ +++  LA+++gL+  qV++WF N R +
  GSMUA_Achr1P06400_001 314 FEHflHPYPNDADKHILARQTGLSRGQVSNWFINARVR 351
                            554459******************************88 PP

2BELL91.58.5e-30179247472
                   BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                            elqk ka+Lls+leeVd rY++y+e+++ v++ Fe+v g g+a  Y+ lA+ka+SrhFrcL+d i++qi
  GSMUA_Achr1P06400_001 179 ELQKIKAQLLSMLEEVDMRYRKYYEEMRGVVAWFEVVGGEGAASAYAGLASKAMSRHFRCLRDGIVGQI 247
                            8999***************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.3E-42119245IPR006563POX domain
PfamPF075268.9E-41121243IPR006563POX domain
PROSITE profilePS5007111.758292355IPR001356Homeobox domain
SMARTSM003898.1E-9295359IPR001356Homeobox domain
CDDcd000862.71E-11295356No hitNo description
SuperFamilySSF466897.27E-17296361IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-27298361IPR009057Homeodomain-like
PfamPF059202.7E-17312351IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 516 aa     Download sequence    Send to blast
MAHESHYNEF PMQGFEHSHE FFGIQPGMEI LGVPSKHQSW QAAASVSPWQ VDNSSSSSSS  60
SLRPLFSCVR TQRPSGGPSL SLLDMKHSAA LVGVPQPPEQ YSAAGDKPQL RAAYHLQQQQ  120
LRNSKFLGPA QELLNEFCGV TGQSSSKKKP NKTNHEGEAG KPSLSSPWHQ SLRSMDLVEL  180
QKIKAQLLSM LEEVDMRYRK YYEEMRGVVA WFEVVGGEGA ASAYAGLASK AMSRHFRCLR  240
DGIVGQIRAV KEATGEKDSA APGTTPGETP RLRMLDQRIR RQKAFQQGTM EPHPWRPQRG  300
LPDRSVSVLR AWLFEHFLHP YPNDADKHIL ARQTGLSRGQ VSNWFINARV RLWKPMVEEM  360
YLEETKELEN QADQAPTGRE HNDHPNPNPN SGLSFDQKPL PVQPLVDSES LSSIINSSHH  420
SDQTLHQYRQ QHHRHVSDLG FPYSSSSSST GVSLTLGLQH HSGGGMSLSL LHDSQLFSAD  480
HVDDDQQVHF SISDGEAVNL PYRDLMGAQL LQDMTR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-15301359563Homeobox protein Meis2
3k2a_B4e-15301359563Homeobox protein Meis2
4xrm_A4e-15301359563Homeobox protein Meis2
4xrm_B4e-15301359563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009395039.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-103BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLM0RXJ80.0M0RXJ8_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P06400_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63983547
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.25e-77BEL1-like homeodomain 2